PDB entry 1th1

View 1th1 on RCSB PDB site
Description: Beta-catenin in complex with a phosphorylated APC 20aa repeat fragment
Class: cell adhesion/antitumor protein
Keywords: protein-protein complex
Deposited on 2004-05-31, released 2004-09-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Gene: CTNNB1, CTNNB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1th1a_
  • Chain 'B':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Gene: CTNNB1, CTNNB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1th1b_
  • Chain 'C':
    Compound: adenomatous polyposis coli protein
    Species: HOMO SAPIENS
    Gene: APC, DP2.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25054
      • modified residue (125)
      • modified residue (142-143)
      • modified residue (145)
      • modified residue (148)
  • Chain 'D':
    Compound: adenomatous polyposis coli protein
    Species: HOMO SAPIENS
    Gene: APC, DP2.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25054
      • modified residue (125)
      • modified residue (142-143)
      • modified residue (145)
      • modified residue (148)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1th1A (A:)
    khavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrsp
    qmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvl
    fyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqesk
    liilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltd
    psqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnny
    knkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglp
    vvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrts
    mggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqr
    vaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th1A (A:)
    daelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqn
    tndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlll
    hqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqal
    vnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwt
    lrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggi
    ealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshw
    plikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsqfvegvrmeeiv
    egctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaea
    ieaegatapltellhsrnegvatyaaavlfrmse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1th1B (B:)
    khavvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrsp
    qmvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvl
    fyaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqesk
    liilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltd
    psqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnny
    knkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglp
    vvvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrts
    mggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqr
    vaagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th1B (B:)
    aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
    ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
    qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
    nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
    rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
    alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
    likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsqfvegvrmeeive
    gctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeai
    eaegatapltellhsrnegvatyaaavlfrmse
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.