PDB entry 1tgx

View 1tgx on RCSB PDB site
Description: x-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes
Class: cytotoxin
Keywords: cytotoxin
Deposited on 1993-11-24, released 1994-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-cardiotoxin
    Species: Naja nigricollis [TaxId:8654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tgxa_
  • Chain 'B':
    Compound: gamma-cardiotoxin
    Species: Naja nigricollis [TaxId:8654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tgxb_
  • Chain 'C':
    Compound: gamma-cardiotoxin
    Species: Naja nigricollis [TaxId:8654]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tgxc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgxA (A:)
    lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgxB (B:)
    lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgxC (C:)
    lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn