PDB entry 1tgx
View 1tgx on RCSB PDB site
Description: x-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes
Class: cytotoxin
Keywords: cytotoxin
Deposited on
1993-11-24, released
1994-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-06-16, with a file datestamp of
2009-06-12.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: gamma-cardiotoxin
Species: Naja nigricollis [TaxId:8654]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1tgxa_ - Chain 'B':
Compound: gamma-cardiotoxin
Species: Naja nigricollis [TaxId:8654]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1tgxb_ - Chain 'C':
Compound: gamma-cardiotoxin
Species: Naja nigricollis [TaxId:8654]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1tgxc_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1tgxA (A:)
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1tgxB (B:)
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1tgxC (C:)
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn