PDB entry 1tgs

View 1tgs on RCSB PDB site
Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Deposited on 1982-09-27, released 1983-01-18
The last revision prior to the SCOP 1.55 freeze date was dated 1985-03-14, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Domains in SCOP 1.55: d1tgsi_
  • Chain 'Z':
    Domains in SCOP 1.55: d1tgsz_

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tgsI (I:)
tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tgsZ (Z:)
dkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvv
egneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqcli
sgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsg
gpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn