PDB entry 1tgs

View 1tgs on RCSB PDB site
Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
Class: complex (proteinase/inhibitor)
Keywords: complex (proteinase/inhibitor)
Deposited on 1982-09-27, released 1983-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: pancreatic secretory trypsin inhibitor (kazal type)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tgsi_
  • Chain 'Z':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tgsz_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgsI (I:)
    tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1tgsZ (Z:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgsZ (Z:)
    dkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvv
    egneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqcli
    sgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsg
    gpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn