PDB entry 1tgr

View 1tgr on RCSB PDB site
Description: Crystal Structure of mini-IGF-1(2)
Class: hormone/growth factor
Keywords: IGF-I, IGF-1, Disulfide Isomerization, recepter binding, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2004-05-29, released 2004-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.198
AEROSPACI score: -1.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor ia
    Species: Homo sapiens [TaxId:9606]
    Gene: E.coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01343 (31-51)
      • engineered (28)
      • linker (29-30)
    Domains in SCOPe 2.01: d1tgra_
  • Chain 'B':
    Compound: insulin-like growth factor ia
    Species: Homo sapiens [TaxId:9606]
    Gene: E.coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01343 (31-51)
      • engineered (28)
      • linker (29-30)
    Domains in SCOPe 2.01: d1tgrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgrA (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkpkakgivdeccfrscdlrrlemyca
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgrB (B:)
    gpetlcgaelvdalqfvcgdrgfyfnkpkakgivdeccfrscdlrrlemyca