PDB entry 1tgq

View 1tgq on RCSB PDB site
Description: Solution NMR Structure of Protein Dynein Light Chain 2A, Cytoplasmic; Northeast Structural Genomics Consortium Target HR2106
Deposited on 2004-05-29, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1tgqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tgqA (A:)
  maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
  dpqndltflrirskkneimvapdkdyfliviqnpte