PDB entry 1tgq

View 1tgq on RCSB PDB site
Description: Solution NMR Structure of Protein Dynein Light Chain 2A, Cytoplasmic; Northeast Structural Genomics Consortium Target HR2106
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, Protein Structure Initiative, PSI, Northeast Structural Genomics Consortium, NESG, Dynein light chain 2A, cytoplasmic, NMR
Deposited on 2004-05-29, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-11-01, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: HOMO SAPIENS
    Gene: DNCL2A, DNLC2A, BITH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tgqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tgqA (A:)
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte