PDB entry 1tgo

View 1tgo on RCSB PDB site
Description: thermostable b type dna polymerase from thermococcus gorgonarius
Deposited on 1999-02-23, released 1999-03-22
The last revision prior to the SCOP 1.69 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgoA (A:)
    mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
    ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
    lidkglipmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknidlpy
    vdvvstekemikrflkvvkekdpdvlityngdnfdfaylkkrseklgvkfilgregsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
    tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayernelapnkpderelarrresyaggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkmkatidpiekklld
    yrqraikilansfygyygyakarwyckecaesvtawgrqyiettireieekfgfkvlyad
    tdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgffvtkkkyavidee
    dkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklskyevppekl
    viyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgsgrigdraipfdef
    dpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglgawlkpkt