PDB entry 1tgn

View 1tgn on RCSB PDB site
Description: structure of bovine trypsinogen at 1.9 angstroms resolution
Deposited on 1979-09-19, released 1979-10-19
The last revision prior to the SCOP 1.55 freeze date was dated 1984-10-22, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tgn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tgn_ (-)
vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn