PDB entry 1tgn

View 1tgn on RCSB PDB site
Description: structure of bovine trypsinogen at 1.9 angstroms resolution
Class: hydrolase zymogen (serine proteinase)
Keywords: hydrolase zymogen (serine proteinase)
Deposited on 1979-09-19, released 1979-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tgna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tgnA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgnA (A:)
    vggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvvegn
    eqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgw
    gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
    vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn