PDB entry 1tgm

View 1tgm on RCSB PDB site
Description: Crystal structure of a complex formed between group II phospholipase A2 and aspirin at 1.86 A resolution
Class: hydrolase
Keywords: phospholipase A2, enzyme, complex, HYDROLASE
Deposited on 2004-05-28, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59071 (0-120)
      • conflict (32)
    Domains in SCOPe 2.07: d1tgma_
  • Heterogens: AIN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgmA (A:)
    sllefgkmileetgklaipsyssygcycgwggsgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c