PDB entry 1tgm

View 1tgm on RCSB PDB site
Description: Crystal structure of a complex formed between group II phospholipase A2 and aspirin at 1.86 A resolution
Class: hydrolase
Keywords: phospholipase A2, enzyme, complex
Deposited on 2004-05-28, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russelli russelli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
    • conflict (32)
  Domains in SCOP 1.73: d1tgma_
• Heterogens: AIN, CA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tgmA (A:)
  sllefgkmileetgklaipsyssygcycgwggsgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c