PDB entry 1tgl

View 1tgl on RCSB PDB site
Description: a serine protease triad forms the catalytic centre of a triacylglycerol lipase
Deposited on 1990-02-05, released 1990-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.138
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tgl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgl_ (-)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
    anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglcs