PDB entry 1tgl

View 1tgl on RCSB PDB site
Description: a serine protease triad forms the catalytic centre of a triacylglycerol lipase
Class: hydrolase
Keywords: hydrolase, carboxylic esterase
Deposited on 1990-02-05, released 1990-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.138
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triacyl-glycerol acylhydrolase
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19515 (Start-267)
      • conflict (180)
      • conflict (219)
    Domains in SCOPe 2.08: d1tgla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tglA (A:)
    singgiraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliy
    dtnamvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqn
    elvatvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvg
    npafanyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdle
    tsdcsnsivpftsvldhlsyfgintglcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tglA (A:)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
    anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglcs