PDB entry 1tgh

View 1tgh on RCSB PDB site
Description: tata binding protein (tbp)/DNA complex
Class: transcription/DNA
Keywords: transcription factor, DNA binding protein, DNA, transcription/DNA complex
Deposited on 1996-02-13, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.214
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tata binding protein (tbp))
    Species: Homo sapiens [TaxId:9606]
    Gene: tbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tgha1, d1tgha2
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*tp*ap*tp*ap*tp*ap*tp*ap*cp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*tp*ap*tp*ap*tp*ap*tp*ap*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tghA (A:)
    gsrgsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalif
    ssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglv
    lthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkg
    frktt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tghA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrkt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.