PDB entry 1tgb

View 1tgb on RCSB PDB site
Description: crystal structure of bovine trypsinogen at 1.8 angstroms resolution. ii. crystallographic refinement, refined crystal structure and comparison with bovine trypsin
Deposited on 1979-03-07, released 1979-06-13
The last revision prior to the SCOP 1.55 freeze date was dated 1985-03-14, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tgb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tgb_ (-)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn