PDB entry 1tgb

View 1tgb on RCSB PDB site
Description: crystal structure of bovine trypsinogen at 1.8 angstroms resolution. II. crystallographic refinement, refined crystal structure and comparison with bovine trypsin
Class: hydrolase zymogen (serine proteinase)
Keywords: hydrolase zymogen (serine proteinase)
Deposited on 1979-03-07, released 1979-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tgba_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tgbA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgbA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn