PDB entry 1tg7

View 1tg7 on RCSB PDB site
Description: Native structure of beta-galactosidase from Penicillium sp.
Class: hydrolase
Keywords: TIM barrel domain, glycoside hydrolase, family GH35, glycoprotein, Penicillium, HYDROLASE
Deposited on 2004-05-28, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Penicillium sp. [TaxId:5081]
    Database cross-references and differences (RAF-indexed):
    • GB CAF32457 (0-970)
    Domains in SCOPe 2.07: d1tg7a1, d1tg7a2, d1tg7a3, d1tg7a4, d1tg7a5
  • Heterogens: NAG, BMA, MAN, NA, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tg7A (A:)
    llqkyvtwdehsifvngerlmifsgevhpyrlpvaslyidifekvkalgfncvsfyvdwa
    llegnpghysaegifdlqpffdaakeagiyllarpgpyinaevsgggfpgwlqrvdgilr
    tsdeaylkatdnyasniaatiakaqitnggpiilyqpeneysgaccgyngfpdgsymqyi
    edhardagivvpfisndawaaghnapgtgagavdiyghdsyplgfdcanpstwpsgnlpt
    yfhtsheqqspstpyslvefqggafdpwggvgfakcaallnhefervfykndfsfgvafl
    nlymifggtnwgnlghpggytsydygsaisesrnitrekyselkllgnfakvspgylvan
    pgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsagnltip
    qlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpgehhefav
    sgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflldrnsaynywvpq
    vptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattpievvgapsgak
    nlvingkktqtkvdkngiwsasvaytapkvqlpslkslkwksvdtlpeakntyddsawts
    adhaytnnsahslqtptslfasdygyhtgallfrghftangkektffvqtkggtayghsi
    winetyvgswagtsindnnnatytlptlqsgknyvitvvidnmgldedwtigsedmknpr
    giiqyslsgqeasaiswkltgnlggenyrdtvrgplnegglyaerqgfhqpqpptqkwds
    sspftgltkpgirfystsfdldlpsgydiplyfnfgnststpaayrvqlyvngyqygkyv
    nnigpqtsfpvpegilnyhgtnwlalslwaqedngakldsfelinttpvltslgevksvn
    qpkyqarkgay