PDB entry 1tg5

View 1tg5 on RCSB PDB site
Description: crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645
Deposited on 2004-05-28, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tg5A (A:)
    mgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstg
    nmvhasylltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvra
    vaievedaesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekse
    flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
    esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
    emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
    tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyektleak
    qlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg5A (A:)
    knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
    lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
    isvangaipssppivlneavtiaevklygdvvlryvsykaseflpgfervedassfpldy
    girrldhavgnvpelgpaltyvagftgfhqfaesglnsavlasndemvllpinepvhgtk
    sqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvg
    dvlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcyqsggcggfg
    kgnfselfksi