PDB entry 1tg4

View 1tg4 on RCSB PDB site
Description: Design of specific inhibitors of groupII phospholipase A2(PLA2): Crystal structure of the complex formed between russells viper PLA2 and designed peptide Phe-Leu-Ala-Tyr-Lys at 1.7A resolution
Class: hydrolase
Keywords: phospholipase a2,flayk,complex,specific inhibitor,crystal structure, hydrolase
Deposited on 2004-05-28, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tg4a_
  • Chain 'I':
    Compound: FLAYK peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1TG4 (0-4)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tg4A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'I':
    No sequence available.