PDB entry 1tg2

View 1tg2 on RCSB PDB site
Description: Crystal structure of phenylalanine hydroxylase A313T mutant with 7,8-dihydrobiopterin bound
Class: oxidoreductase
Keywords: phenylalanine hydroxylase phenylketonuria mutant A313T in complex with cofactor analogue 7,8-dihydrobiopterin, OXIDOREDUCTASE
Deposited on 2004-05-28, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine-4-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00439 (0-307)
      • engineered (196)
    Domains in SCOPe 2.08: d1tg2a_
  • Heterogens: FE, H2B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tg2A (A:)
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl