PDB entry 1tg1

View 1tg1 on RCSB PDB site
Description: Crystal Structure of the complex formed between russells viper phospholipase A2 and a designed peptide inhibitor PHQ-Leu-Val-Arg-Tyr at 1.2A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: phospholipase a2, hydrolase-hydrolase inhibitor complex
Deposited on 2004-05-28, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii russellii [TaxId:31159]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg1a_
  • Chain 'C':
    Compound: peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1TG1 (Start-4)
  • Heterogens: SO4, ACY, MOH, PHQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tg1A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'C':
    No sequence available.