PDB entry 1tg1

View 1tg1 on RCSB PDB site
Description: crystal structure of the complex formed between russells viper phospholipase a2 and a designed peptide inhibitor phq-leu-val-arg-tyr at 1.2a resolution
Deposited on 2004-05-28, released 2004-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.188
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tg1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tg1A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c