PDB entry 1tfz

View 1tfz on RCSB PDB site
Description: structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4- hydroxyphenylpyruvate dioxygenases
Deposited on 2004-05-27, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfzA (A:)
    mgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstg
    nmvhasylltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvra
    vaievedaesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekse
    flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
    esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
    emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
    tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyektleak
    qlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfzA (A:)
    npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
    rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
    svangaipssppivlneavtiaevklygdvvlryvsykeflpgfervedassfpldygir
    rldhavgnvpelgpaltyvagftgfhqfasglnsavlasndemvllpinepvhgksqiqt
    ylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsd
    dqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmqsggcggfgkgnfs
    elfk