PDB entry 1tfw

View 1tfw on RCSB PDB site
Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
Class: transferase/RNA
Keywords: CCA-adding Complex, ATP
Deposited on 2004-05-27, released 2004-08-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tfwa1, d1tfwa2, d1tfwa3
  • Chain 'B':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tfwb1, d1tfwb2, d1tfwb3
  • Chain 'C':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tfwc1, d1tfwc2, d1tfwc3
  • Chain 'D':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Gene: CCA, AF2156
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tfwd1, d1tfwd2, d1tfwd3
  • Chain 'E':
    Compound: 5'-r(*gp*cp*gp*gp*ap*up*cp*cp*gp*cp*ap*c)-3'
  • Chain 'F':
    Compound: 5'-r(*gp*cp*gp*gp*ap*cp*cp*cp*gp*cp*ap*c)-3'
  • Chain 'G':
    Compound: 5'-r(*gp*cp*gp*gp*ap*up*cp*cp*gp*cp*ap*cp*c)-3'
  • Chain 'H':
    Compound: 5'-r(*gp*cp*gp*gp*ap*up*cp*cp*gp*cp*ap*cp*c)-3'
  • Chain 'I':
    Compound: 5'-r(*gp*cp*gp*gp*ap*up*cp*cp*gp*cp*ap*cp*c)-3'
  • Chain 'J':
    Compound: 5'-r(*cp*gp*cp*gp*gp*ap*up*cp*cp*gp*cp*ap*c)-3'
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfwA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfwB (B:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfwC (C:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfwD (D:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.