PDB entry 1tfv

View 1tfv on RCSB PDB site
Description: crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
Class: signaling protein
Keywords: signaling glycoprotein, involution, buffalo milk, signaling protein
Deposited on 2004-05-27, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mammary gland protein 40
    Species: Bubalus bubalis [TaxId:89462]
    Database cross-references and differences (RAF-indexed):
    • GB AAP42568 (0-360)
    Domains in SCOPe 2.08: d1tfva1, d1tfva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfvA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v