PDB entry 1tfu

View 1tfu on RCSB PDB site
Description: phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: TRANSPORT PROTEIN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2004-05-27, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.229
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: COAD, KDTB, RV2965C, MT3043, MTCY349.22, U0002E, MB2989C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tfua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfuA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrln