PDB entry 1tfr

View 1tfr on RCSB PDB site
Description: RNAse h from bacteriophage t4
Class: hydrolase
Keywords: 5u-3u exonuclease, RNA:RNA, DNA:DNA, metal-dependent, magnesium-containing, hydrolase (nucleic acid)
Deposited on 1996-04-27, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 RNAse h
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tfra1, d1tfra2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfrA (A:)
    mdlemmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkakt
    lgytkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaymp
    yivmdidkyeaddhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
    ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
    vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
    sinef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfrA (A:)
    kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
    naksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeaddhiavlvk
    kfsleghkiliissdgdftqlhkypnvkqwspmhkkwvkigsaeidcmtkilkgdkkdnv
    asvkvrsdfwftrvegertpsmktsiveaiandreqakvllteseynrykenlvlidfdy
    ipdniasnivnyynsyklpprgkiysyfvkaglskltnsinef