PDB entry 1tfp

View 1tfp on RCSB PDB site
Description: transthyretin (formerly known as prealbumin)
Class: transport (thyroxine)
Keywords: transport (thyroxine), albumin, retinol-binding
Deposited on 1996-01-05, released 1996-06-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.199
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tfpa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tfpb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfpA (A:)
    aplvshgsvdskcplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeihe
    ltteeqfvegvyrvefdtssywkglglspfheyadvvftandsghrhytiaallspfsys
    ttavvsdpqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfpA (A:)
    cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
    rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tfpB (B:)
    aplvshgsvdskcplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeihe
    ltteeqfvegvyrvefdtssywkglglspfheyadvvftandsghrhytiaallspfsys
    ttavvsdpqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfpB (B:)
    cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
    rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs