PDB entry 1tfo

View 1tfo on RCSB PDB site
Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
Class: toxin/toxin inhibitor
Keywords: protein-protein complex, toxin/toxin inhibitor complex
Deposited on 2004-05-27, released 2005-03-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.258
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin D
    Species: Escherichia coli [TaxId:562]
    Gene: CDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1tfoa_
  • Chain 'B':
    Compound: Colicin D immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: CDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11899 (Start-85)
      • expression tag (86)
    Domains in SCOPe 2.01: d1tfob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfoA (A:)
    ldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekg
    skvyfnpntmnvviiksngeflsgwkinpdadngriyletgel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tfoB (B:)
    nkmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepd
    adranyeiddnglkvevrsilekfklhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfoB (B:)
    kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
    dranyeiddnglkvevrsilekfklh