PDB entry 1tfm

View 1tfm on RCSB PDB site
Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form
Class: toxin
Keywords: PROTEIN-INHIBITOR COMPLEX, BETA TREFOIL, Ribosome inactivating protein, TOXIN
Deposited on 2004-05-27, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Himalayan mistletoe ribosome-inactivating protein
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB AAT37532 (0-239)
    Domains in SCOPe 2.07: d1tfma_
  • Chain 'B':
    Compound: Himalayan mistletoe ribosome-inactivating protein
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB AAT37532 (0-254)
    Domains in SCOPe 2.07: d1tfmb1, d1tfmb2
  • Heterogens: NAG, GAL, P6C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfmA (A:)
    yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
    ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
    kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
    lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfmB (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpe
    qnqdqcltsgrdsvaginivscsggssgqrwvftnegailnlknglamdvanpglgqiii
    ypatgkpnqmwlpvp