PDB entry 1tfm

View 1tfm on RCSB PDB site
Description: crystal structure of a ribosome inactivating protein in its naturally inhibited form
Deposited on 2004-05-27, released 2004-07-13
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfmA (A:)
    yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
    ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
    kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
    lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfmB (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpe
    qnqdqcltsgrdsvaginivscsggssgqrwvftnegailnlknglamdvanpglgqiii
    ypatgkpnqmwlpvp