PDB entry 1tfh

View 1tfh on RCSB PDB site
Description: extracellular domain of human tissue factor
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfhA (A:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkvn
    vtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgen
    ycfsvqavipsrtvnrkstdspvecmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfhA (A:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnvageplyenspeftpyletnlgqptiqsfeqvgtkvnvtved
    ertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsv
    qavipsrtvnrkstdspvecmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tfhB (B:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkvn
    vtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgen
    ycfsvqavipsrtvnrkstdspvecm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfhB (B:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnveplyenspeftpyletnlgqptiqstkvnvtvedertlvnt
    flslrdvfgkdliytlyygkktaktntneflidvdkgcfsvqavipsrtvnrkstdspve
    cm