PDB entry 1tfd

View 1tfd on RCSB PDB site
Description: high-resolution x-ray studies on rabbit serum transferrin: preliminary structure analysis of the n-terminal half-molecule at 2.3 angstroms resolution
Class: iron transport protein
Keywords: iron transport protein
Deposited on 1990-08-16, released 1993-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19134 (Start-303)
      • conflict (181)
    Domains in SCOPe 2.05: d1tfda_
  • Heterogens: CO3, FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfdA (A:)
    vtektvrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadav
    tldaglvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkscht
    glgrsagwnipigllycdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcs
    ssqpyfgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeq
    chlarvpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsay
    gffk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfdA (A:)
    vrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtldag
    lvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtglgrs
    agwnipigllycdlpeprkplekavasffsgscvpcadqlcqlcpgcgcsssqpyfgysg
    afkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqchlarvpsha
    vvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygffk