PDB entry 1tfb

View 1tfb on RCSB PDB site
Description: nmr studies of human general transcription factor tfiib: dynamics and interaction with vp16 activation domain, 20 structures
Deposited on 1996-11-14, released 1997-03-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tfb_ (-)
srammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrq
egvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqm
aathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyr
liyprapdlfptdfkfdtpvdklpql