PDB entry 1tf7

View 1tf7 on RCSB PDB site
Description: Crystal Structure of Circadian Clock Protein KaiC
Class: circadian clock protein
Keywords: homohexamer, hexamer, CIRCADIAN CLOCK PROTEIN
Deposited on 2004-05-26, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7a1, d1tf7a2
  • Chain 'B':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7b1, d1tf7b2
  • Chain 'C':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7c1, d1tf7c2
  • Chain 'D':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7d1, d1tf7d2
  • Chain 'E':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7e1, d1tf7e2
  • Chain 'F':
    Compound: KaiC
    Species: Synechococcus sp. [TaxId:1131]
    Gene: PCC7942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tf7f1, d1tf7f2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tf7A (A:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7A (A:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tf7B (B:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7B (B:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tf7C (C:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7C (C:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tf7D (D:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7D (D:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tf7E (E:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7E (E:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tf7F (F:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf7F (F:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptri