PDB entry 1tf4

View 1tf4 on RCSB PDB site
Description: endo/exocellulase from thermomonospora
Class: glycosyl hydrolase
Keywords: glycosyl hydrolase, cellulose degradation
Deposited on 1997-05-30, released 1997-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: BAMH1-PST1 FRAGMENT OF T. FUSC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tf4a1, d1tf4a2
  • Chain 'B':
    Compound: t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: BAMH1-PST1 FRAGMENT OF T. FUSC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tf4b1, d1tf4b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tf4A (A:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tf4B (B:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap