PDB entry 1tf2

View 1tf2 on RCSB PDB site
Description: Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis
Class: protein transport
Keywords: ATPase, helicase, translocation, secretion, PROTEIN TRANSPORT
Deposited on 2004-05-26, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase secA subunit
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SECA, DIV+, BSU35300
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28366 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d1tf2a1, d1tf2a2, d1tf2a3, d1tf2a4, d1tf2a5
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tf2A (A:)
    gphmlgilnkmfdptkrtlnryekiandidairgdyenlsddalkhktiefkerlekgat
    tddllveafavvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvyln
    altgkgvhvvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystn
    nelgfdylrdnmvlykeqmvqrplhfavidevdsilideartpliisgqaakstklyvqa
    nafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhvalnhhinqalkah
    vamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiqnesmtlatitf
    qnyfrmyeklagmtgtakteeeefrniynmqvvtiptnrpvvrddrpdliyrtmegkfka
    vaedvaqrymtgqpvlvgtvavetseliskllknkgiphqvlnaknhereaqiieeagqk
    gavtiatnmagrgtdiklgegvkelgglavvgterhesrridnqlrgrsgrqgdpgitqf
    ylsmedelmrrfgaertmamldrfgmddstpiqskmvsravessqkrvegnnfdsrkqll
    qyddvlrqqreviykqrfevidsenlreivenmikssleraiaaytpreelpeewkldgl
    vdlinttyldegaleksdifgkepdemlelimdriitkynekeeqfgkeqmrefekvivl
    ravdskwmdhidamdqlrqgihlrayaqtnplreyqmegfamfehmiesiedevakfvmk
    aeiennlereevvqgqttahqpqegddnkkakkapvrkvvdigrnapchcgsgkkykncc
    grte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf2A (A:)
    hmlgilnkrtlnryekiandidairgdyenlsddalkhktiefkerlekgattddllvea
    favvreasrrvtgmfpfkvqlmggvalhdgniaemktgegktltstlpvylnaltgkgvh
    vvtvneylasrdaeqmgkifeflgltvglnlnsmskdekreayaaditystnnelgfdyl
    rdnmvlykeqmvqrplhfavidevdsilideartpliisgqaakstklyvqanafvrtlk
    aekdytydiktkavqlteegmtkaekafgidnlfdvkhvalnhhinqalkahvamqkdvd
    yvvedgqvvivdsftgrlmkgrryseglhqaieakegleiqnesmtlatitfqnyfrmye
    klagmtgtakteeeefrniynmqvvtiptnrpvvrddrpdliyrtmegkfkavaedvaqr
    ymtgqpvlvgtvavetseliskllknkgiphqvlnaknhereaqiieeagqkgavtiatn
    magrgtdiklgegvkelgglavvgterhesrridnqlrgrsgrqgdpgitqfylsmedel
    mrrfgaertmamldrfgmddstpiqskmvsravessqkrvegnnfdsrkqllqyddvlrq
    qreviykqrfevidsenlreivenmikssleraiaaytpreeewkldglvdlinttylde
    galeksdifgkepdemlelimdriitkynekeeqfgkeqmrefekvivlravdskwmdhi
    damdqlrqgihlrayaqtnplreyqmegfamfehmiesiedevakfvmkaei