PDB entry 1tf1

View 1tf1 on RCSB PDB site
Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain
Deposited on 2004-05-26, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tf1a_
  • Chain 'B':
    Domains in SCOP 1.71: d1tf1b_
  • Chain 'C':
    Domains in SCOP 1.71: d1tf1c_
  • Chain 'D':
    Domains in SCOP 1.71: d1tf1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tf1A (A:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1A (A:)
    grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
    gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
    vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
    glka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tf1B (B:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1B (B:)
    yfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlp
    lhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkee
    hvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tf1C (C:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1C (C:)
    lyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrl
    plhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdke
    ehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tf1D (D:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1D (D:)
    grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
    gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
    vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
    glk