PDB entry 1tez

View 1tez on RCSB PDB site
Description: complex between DNA and the DNA photolyase from anacystis nidulans
Class: lyase/DNA
Keywords: photolyase; DNA repair; light-driven electron transfer
Deposited on 2004-05-26, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deoxyribodipyrimidine photolyase
    Species: Synechococcus sp.
    Gene: PHR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1teza1, d1teza2
  • Chain 'B':
    Compound: Deoxyribodipyrimidine photolyase
    Species: Synechococcus sp.
    Gene: PHR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tezb1, d1tezb2
  • Chain 'C':
    Compound: Deoxyribodipyrimidine photolyase
    Species: Synechococcus sp.
    Gene: PHR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tezc1, d1tezc2
  • Chain 'D':
    Compound: Deoxyribodipyrimidine photolyase
    Species: Synechococcus sp.
    Gene: PHR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tezd1, d1tezd2
  • Chain 'I':
    Compound: 5'-d(*ap*tp*cp*gp*gp*cp*t*(tcp)p*cp*gp*c)-3'
  • Chain 'J':
    Compound: 5'-d(p*cp*gp*ap*ap*gp*cp*cp*gp*a)-3'
  • Chain 'K':
    Compound: 5'-d(*ap*tp*cp*gp*gp*cp*t*(tcp)p*cp*gp*c)-3'
  • Chain 'L':
    Compound: 5'-d(p*cp*gp*ap*ap*gp*cp*cp*gp*a)-3'
  • Chain 'M':
    Compound: 5'-d(*tp*cp*gp*c)-3'
  • Chain 'N':
    Compound: 5'-d(p*gp*cp*cp*gp*a)-3'
  • Chain 'O':
    Compound: 5'-d(*tp*cp*gp*c)-3'
  • Chain 'P':
    Compound: 5'-d(p*gp*cp*cp*gp*a)-3'
  • Heterogens: MG, FAD, HDF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezA (A:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezB (B:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezC (C:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezD (D:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.