PDB entry 1tez

View 1tez on RCSB PDB site
Description: complex between dna and the dna photolyase from anacystis nidulans
Deposited on 2004-05-26, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezA (A:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezB (B:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezC (C:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tezD (D:)
    aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
    lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
    iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
    iaplllselptlkqlgfdwdggfpvepgetaaiarlqefcdraiadydpqrnfpaeagts
    glspalkfgaigirqawqaasaahalsrsdearnsirvwqqelawrefyqhalyhfpsla
    dgpyrslwqqfpwenrealftawtqaqtgypivdaamrqltetgwmhnrcrmivasfltk
    dliidwrrgeqffmqhlvdgdlaannggwqwsassgmdpkplrifnpasqakkfdataty
    ikrwlpelrhvhpkdlisgeitpierrgypapivnhnlrqkqfkalynqlkaai