PDB entry 1tew

View 1tew on RCSB PDB site
Description: structure of hexagonal turkey egg white lysozyme at 1.65 angstroms resolution
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-11-17, released 1995-01-26
The last revision prior to the SCOP 1.75 freeze date was dated 1995-01-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.206
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: turkey egg white lysozyme
    Species: Meleagris gallopavo
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tewa_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tewA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tewA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcr