PDB entry 1ten

View 1ten on RCSB PDB site
Description: structure of a fibronectin type III domain from tenascin phased by mad analysis of the selenomethionyl protein
Class: cell adhesion protein
Keywords: cell adhesion protein
Deposited on 1992-08-28, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tenascin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tena_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tenA (A:)
    rldapsqievkdvtdttalitwfkplaeidgieltygikdvpgdrttidltedenqysig
    nlkpdteyevslisrrgdmssnpaketftt