PDB entry 1ten

View 1ten on RCSB PDB site
Description: structure of a fibronectin type III domain from tenascin phased by mad analysis of the selenomethionyl protein
Class: cell adhesion protein
Keywords: cell adhesion protein
Deposited on 1992-08-28, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tenascin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24821 (0-89)
  Domains in SCOPe 2.08: d1tena_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tenA (A:)
  rldapsqievkdvtdttalitwfkplaeidgieltygikdvpgdrttidltedenqysig
  nlkpdteyevslisrrgdmssnpaketftt