PDB entry 1teh

View 1teh on RCSB PDB site
Description: structure of human liver chichi alcohol dehydrogenase (a glutathione-dependent formaldehyde dehydrogenase)
Class: oxidoreductase
Keywords: nad+ dependent alcohol dehydrogenase glutathione dependent formaldehyde dehydrogenase, oxidoreductase
Deposited on 1996-02-05, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human chichi alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1teha1, d1teha2
  • Chain 'B':
    Compound: human chichi alcohol dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tehb1, d1tehb2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tehA (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tehB (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki