PDB entry 1tea

View 1tea on RCSB PDB site
Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]
Deposited on 2004-05-24, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.121
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1teaA (A:)
    snamtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiae
    qcdviitmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvem
    ldapvsggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqv
    ivalniaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridl
    hikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teaA (A:)
    mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
    itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
    sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivaln
    iaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridlhikdl
    analdtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr