PDB entry 1tea

View 1tea on RCSB PDB site
Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]
Class: oxidoreductase
Keywords: structural genomics, mcsg, protein structure initiative, reductase, tartronate
Deposited on 2004-05-24, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-10-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.121
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tartronate semialdehyde reductase
    Species: Salmonella typhimurium
    Gene: GARR
    Database cross-references and differences (RAF-indexed):
    • GB NP_462161 (Start-298)
      • modified residue (5)
      • modified residue (15)
      • modified residue (19)
      • modified residue (67)
      • modified residue (97)
      • modified residue (119)
      • modified residue (139)
      • modified residue (154)
      • modified residue (157)
      • modified residue (188)
      • modified residue (225)
      • modified residue (227)
      • modified residue (265)
      • modified residue (267-268)
    Domains in SCOPe 2.07: d1teaa3, d1teaa4
  • Heterogens: TAR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1teaA (A:)
    snamtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiae
    qcdviitmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvem
    ldapvsggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqv
    ivalniaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridl
    hikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teaA (A:)
    mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
    itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
    sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivaln
    iaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridlhikdl
    analdtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr