PDB entry 1te7

View 1te7 on RCSB PDB site
Description: Solution NMR Structure of Protein yqfB from Escherichia coli. Northeast Structural Genomics Consortium Target ET99
Class: structural genomics, unknown function
Keywords: ALPHA + BETA, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-05-24, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0267 protein yqfB
    Species: Escherichia coli [TaxId:562]
    Gene: YQFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1te7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1te7A (A:)
mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatst
vtldtltekhaeqenmtltelkkviadiypgqtqfyviefkcl