PDB entry 1te6

View 1te6 on RCSB PDB site
Description: Crystal Structure of Human Neuron Specific Enolase at 1.8 angstrom
Deposited on 2004-05-24, released 2004-09-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1te6A (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1te6A (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1te6B (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1te6B (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl