PDB entry 1te6

View 1te6 on RCSB PDB site
Description: Crystal Structure of Human Neuron Specific Enolase at 1.8 angstrom
Class: lyase
Keywords: enolase, neurons, isozymes, surface charges, negative cooperativity, LYASE
Deposited on 2004-05-24, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09104 (0-432)
      • expression tag (433)
    Domains in SCOPe 2.07: d1te6a1, d1te6a2, d1te6a3
  • Chain 'B':
    Compound: Gamma enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1te6b1, d1te6b2
  • Heterogens: MG, PO4, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1te6A (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1te6A (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1te6B (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1te6B (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl